PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00016342-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family LBD
Protein Properties Length: 328aa    MW: 36193.4 Da    PI: 7.4096
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00016342-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.35.4e-4371061100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l+  +reda++sl+yeAear+rdPvyG+vg+i+ lq++l+q++
  WALNUT_00016342-RA   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELNAAQREDAVNSLAYEAEARLRDPVYGCVGFISILQHRLKQVQ 97 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++l  +k+e
  WALNUT_00016342-RA  98 TDLFNAKKE 106
                         **9888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8516107IPR004883Lateral organ boundaries, LOB
PfamPF031956.3E-437103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELNAAQR  60
EDAVNSLAYE AEARLRDPVY GCVGFISILQ HRLKQVQTDL FNAKKELASY IGPQAMLTIL  120
QPPGYMTQQQ HPGNPSSSAV LPYNMSPMLG IPTGAPTRGG ALVIREPQQQ HHQHQLFEAQ  180
QLAAAVAARE QQEILRSYEQ QQQLQQHAQP HQHQHQHQHQ HQHQAELVRF NSGFDPAAAA  240
GGSVTATGFN QVNAAAAAMS PSLALGTFEN PYDIQPQQGE HHGHHHHHQL QAQLLLQPQQ  300
PHAHQQGQQT QPQSKPESEE GRSVGPSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491765.11e-127PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ33e-94LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0B0PS921e-137A0A0B0PS92_G
STRINGVIT_07s0197g00020.t011e-117(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-78ASYMMETRIC LEAVES 2-like 1